Retatrutide

Properties

Substance class Synthetic peptide of 39 amino acid residues, developed by Eli Lilly and Company under the code LY3437943. FDA's substance record gives the full systematic name, from which the structure can be read directly: three residues are non-standard (2-methylalanine at positions 2 and 20, 2-methyl-L-leucine at position 13), the C-terminus is a serinamide rather than a free acid, and the lysine at position 17 carries an N6 side chain built from L-gamma-glutamate, two units of 2-[2-(2-aminoethoxy)ethoxy]acetyl, and a 19-carboxy-1-oxononadecyl (C20 diacid) fatty-acid group. That acylation is the structural feature that distinguishes it from an unmodified peptide and underlies its long circulating persistence. source
Sequence YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS. READ THIS CAVEAT BEFORE USING THE STRING. FDA's substance registry renders the backbone in standard single-letter code, which silently flattens the three non-standard residues: the "A" at position 2 and the "A" at position 20 are 2-methylalanine (Aib), and the "L" at position 13 is 2-methyl-L-leucine. The string also omits the C-terminal amide and the acyl side chain on Lys17. It is a backbone index, not a synthesis specification. source
Other names LY3437943; LY-3437943. Registered as an International Nonproprietary Name (INN 12350) and a United States Adopted Name (USAN JK-35), unlike most compounds in this category, which circulate under common names that no naming body has ever assigned. source
Cas number 2381089-83-2 source
Unii NOP2Y096GV source
Sodium salt identifiers Retatrutide sodium is a separate registered substance from retatrutide, with its own UNII, LQ42M82ZU6. FDA's substance record for the sodium form carries no CAS number. As with BPC-157's free base and acetate forms, a source that says "retatrutide" may mean either, and a number attached to one does not transfer to the other without checking. source
Molecular formula C221H342N46O68. PROVENANCE: PubChem titles this record "Retatrutide (sodium salt)" although the formula it carries contains no sodium atom, so the depicted species is the free form. Recorded with that discrepancy stated rather than silently resolved. source
Molecular weight 4731 g/mol source
Molecular weight independent measurement An independent Australian laboratory analysis of products sold as retatrutide states the expected molecular weight of authentic retatrutide as 4730.477 Da, and reports that the measured molecular weights of all three samples it tested closely matched it. This is an independent analytical figure rather than a computed one, and it is recorded alongside the PubChem value rather than in place of it. Da source
Mechanism A single peptide with agonist activity at three receptors: the glucagon receptor (GCGR), the glucose-dependent insulinotropic polypeptide receptor (GIPR), and the glucagon-like peptide-1 receptor (GLP-1R). The originating Eli Lilly paper reports that in vitro it shows balanced GCGR and GLP-1R activity but more GIPR activity. source
Distinction from single and dual agonists The third receptor is the difference. Approved incretin products act at GLP-1R alone, or at GIPR and GLP-1R together; retatrutide adds glucagon receptor agonism. In the originating paper's obese-mouse experiments the authors attribute the additional body-weight effect to GCGR-mediated increases in energy expenditure layered on top of the GIPR- and GLP-1R-driven reduction in calorie intake. That mechanistic split is an animal finding from the discovery paper, not a human measurement. source
Half life Approximately 6 days in people with type 2 diabetes. Reported in the phase 1b multiple-ascending-dose trial (NCT04143802), which also found the pharmacokinetics to be dose proportional and concluded that they suggest suitability for once-weekly dosing. This is a trial measurement in a supervised setting, recorded as pharmacology, not as guidance. days source
Dosing frequency in published trials Every published trial below used once-weekly subcutaneous administration, with stepwise dose escalation from a low starting amount. This is a record of how the registered trials were designed. It is not a protocol, and nothing about it transfers outside a trial: the material, the escalation schedule, the monitoring and the discontinuation criteria were all controlled by the sponsor and the investigators. source
Detection window in plasma An anti-doping laboratory that developed an LC-HRMS method to World Anti-Doping Agency criteria reported limits of detection of 6.14 ng/mL in plasma and 2.44 ng/mL in urine, an extended plasma detection window of approximately 56 days after the first dose in four self-administering users, and that neither intact retatrutide nor metabolite-derived signals were detected in urine at any timepoint. Plasma concentration-time profiles were nonmonotonic, which the authors read as prolonged subcutaneous absorption with depot-like release. This is analytical chemistry, not a study of any effect in a person. source
Storage Not established, and there is no authority that could establish it. There is no approved product label for retatrutide in any country and no pharmacopoeial monograph, so no manufacturer storage condition, in-use period or shelf life has been published for it. FDA's published guidance on storage and in-use limits for GLP-1 products addresses compounded drugs; that guidance cannot be applied to retatrutide, because on the same page FDA states retatrutide "cannot be used in compounding under federal law". Any storage figure circulating for this compound therefore traces to a supplier page rather than to a determination by anyone. No peer-reviewed forced-degradation or shelf-life study for retatrutide was located during data entry. source
Approval status Not approved anywhere. FDA states, naming the substance directly, that retatrutide and cagrilintide "are not components of FDA-approved drugs and have not been found safe and effective for any condition." Page content current as of 09/01/2026. source
Approval status outside the united states Also none. A peer-reviewed Australian analysis published in September 2026 describes retatrutide as "not being approved for therapeutic use in Australia or internationally". Reporting on the phase 3 topline results, The Pharmaceutical Journal states that "The drug is currently an investigational molecule and does not have regulatory approval." source
Fda compounding status Prohibited. FDA's published statement reads "Retatrutide and cagrilintide cannot be used in compounding under federal law." On the same page FDA records that it has warned telehealth companies for marketing unapproved drugs such as retatrutide including by direct marketing to consumers, active pharmaceutical ingredient distributors for selling retatrutide and other GLP-1 drugs to compounders, and outsourcing facilities for repackaging retatrutide. This is a stricter position than the one FDA takes on compounds it is merely still evaluating for the 503A Bulks List. source
Fda position on research use labelling FDA states it "has warned companies that have illegally sold unapproved drugs containing semaglutide, tirzepatide, retatrutide, survodutide or mazdutide that are falsely labeled 'for research purposes' or 'not for human consumption.'" The agency's position is that such labelling does not determine regulatory status; the seller's own marketing does. source
Fda enforcement position In a warning letter dated March 31, 2026 to a firm offering a product it called "Retatrutide" (and also "GLP-1-R peptide"), FDA's Center for Drug Evaluation and Research stated "these products are unapproved new drugs under section 505(a) of the Federal Food, Drug, and Cosmetic Act" and that introducing them into interstate commerce violates the Act. FDA wrote that despite the firm's "Research Use Only" and "not intended for human consumption" labelling, evidence from its website established that the products were intended to be drugs for human use. The determination attaches to that firm's products as marketed with those claims; it is not a finding about the molecule in the abstract. source
Regulatory submission status No marketing application has been filed. Reporting Lilly's July 23, 2026 announcement of two further phase 3 results, Pharmaceutical Executive records that Lilly "plans to submit a biologics license application for U.S. approval in the first quarter of 2027" and is completing the chemistry, manufacturing and controls data package required for it. An announced intention to file is not a filing, and a filing is not an approval. source
Expanded access programme A pre-approval expanded access record, NCT07629401, was first posted on June 5, 2026 and is listed as available. It provides single-patient access for adults with severe obesity and at least two serious or life-threatening obesity-related complications who are refractory to the best approved therapy and cannot enrol in a trial. Requests must be initiated by the patient's own physician; the record states that patients and caregivers should be directed to their physician rather than contacting the sponsor. This is the only route outside a clinical trial that the sponsor operates, and it is not a consumer route. source
Trial programme size 33 registered studies with retatrutide as an intervention, as returned by the ClinicalTrials.gov API on 2026-09-16: 14 phase 1, 4 phase 2, 14 phase 3, and 1 expanded access record carrying no phase. 32 of the 33 list Eli Lilly and Company as lead sponsor; the remaining one lists Hudson Biotech. Registered enrolment ranges from 29 participants in a renal impairment study to 10000 in the cardiovascular and kidney outcomes trial. source
Indications studied Per the registered conditions fields on ClinicalTrials.gov: obesity and overweight, type 2 diabetes, knee osteoarthritis, obstructive sleep apnea, chronic kidney disease, atherosclerotic cardiovascular disease, metabolic dysfunction-associated steatotic liver disease, chronic low back pain, and maintenance of weight reduction. Also registered are phase 1 studies in healthy participants, in renal and hepatic impairment, in Japanese and Chinese participants, and drug-drug interaction studies. Listing a condition as studied is not a statement that anything was shown for it. source
Phase 3 programme structure The registrational programme, TRIUMPH, consists of four phase 3 multicentre randomised double-blind studies of weekly subcutaneous retatrutide against placebo in over 5800 participants, using a basket design that evaluates obesity and two related complications, obstructive sleep apnea and knee osteoarthritis, at the same time. TRIUMPH-1 and TRIUMPH-2 are the two weight-management basket trials. Separate phase 3 programmes cover type 2 diabetes (TRANSCEND) and cardiovascular and kidney outcomes (TRIUMPH-Outcomes, NCT06383390). source
Anti doping status Not established by any source this file could verify, and deliberately not inferred. No statement from a national or international anti-doping authority naming retatrutide was retrievable during data entry. What was verified is narrower: the United States Anti-Doping Agency publishes that "GLP-1s are not prohibited in sport" and that the World Anti-Doping Agency is monitoring their use to determine whether they should be prohibited in future. That page names semaglutide, dulaglutide and exenatide, all of them approved drugs; it does not name retatrutide, and retatrutide differs from every product it does name in not being approved by any health authority. This site does not extend that statement to retatrutide in either direction. Athletes should ask their own anti-doping authority rather than rely on this entry. source
Composition of non pharmaceutical supply Measured once, in a small independent sample, and it did not match the label. An Australian analysis of three products sold as retatrutide and labelled as containing 10 mg each found that all three did contain retatrutide by molecular weight, but that content per vial was 5.13 mg (51.3% of labelled), 16.5 mg (165.0%) and 19.0 mg (190.0%) — roughly half to almost double the labelled amount. Elemental impurity testing found no arsenic, cadmium, chromium, nickel or mercury above quantitation limits; lead was detected at 0.7 mg/kg, copper at 0.9 mg/kg and zinc at 3.7 mg/kg, all of which the authors interpreted as substantially below toxicologically relevant exposure thresholds. Their conclusion was that "inaccurate dosing alone may represent an important source of risk". source

What the research does not show

Storage and handling

Not established, and there is no authority that could establish it. There is no approved product label for retatrutide in any country and no pharmacopoeial monograph, so no manufacturer storage condition, in-use period or shelf life has been published for it. FDA's published guidance on storage and in-use limits for GLP-1 products addresses compounded drugs; that guidance cannot be applied to retatrutide, because on the same page FDA states retatrutide "cannot be used in compounding under federal law". Any storage figure circulating for this compound therefore traces to a supplier page rather than to a determination by anyone. No peer-reviewed forced-degradation or shelf-life study for retatrutide was located during data entry. source

Concentration calculator · Research index · Reading a certificate of analysis